PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26253.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 458aa    MW: 50238.6 Da    PI: 6.8293
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26253.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-39121181262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k+l+cprC+s++tkfCyynny+++qPryfCkaC+ryWt+GG++rnvPvG+grrknk+s 
  KHN26253.1 121 PDKILPCPRCNSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNSA 181
                 7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-28121178IPR003851Zinc finger, Dof-type
PfamPF027012.6E-32123179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.686125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MQENKDPAIK LFGQKIAFAG EVDPPAISAG EIDSPPAMDV DKDEEDDFGD SETEDEKDKD  60
PRAEKVSEKT KEADPPPNAA DSKKTPEGIQ NPNTPSIDEE SAKSKTNKSE NNNNNKTLKK  120
PDKILPCPRC NSMDTKFCYY NNYNVNQPRY FCKACQRYWT AGGTMRNVPV GAGRRKNKNS  180
ASHYRHITIS EALQAARIDA APNGTHHLLK PNGRVLSFGL ELDPPICDSM ASVLNLTAEK  240
KGTLNNNSRN NNNNNNNNGD DCSSASSITV SNEENGKSTS QESIVVPNSN GFIHHVPCIS  300
TLPWPYPFPS GAPAMCPPGF PMSFYPAAFW NIPWFPSQHS HHSSAPTPRS PNSPTLGKHS  360
RDDDATKQYH LQEEQPPSRQ RNGSVLVPKT LRIDDPSEAA KSSIWATLGI KNECVTGGGM  420
FKGFQSKKEE KDHVVEASPV LRANPAALSR SLNFHENS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527086.10.0PREDICTED: cyclic dof factor 3-like
SwissprotQ8LFV31e-120CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A0B2R2M50.0A0A0B2R2M5_GLYSO; Dof zinc finger protein DOF3.3
TrEMBLI1KCU10.0I1KCU1_SOYBN; Uncharacterized protein
STRINGGLYMA06G20950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-106cycling DOF factor 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]